Skip to main content

Documentation Index

Fetch the complete documentation index at: https://docs.boltz.bio/llms.txt

Use this file to discover all available pages before exploring further.

Installation

Install the SDK using pip:
pip install boltz-lab

Get Your API Key

  1. Sign up or log in at app.boltz.bio
  2. Navigate to Settings → API Keys
  3. Click Generate New Key
  4. Copy your key (format: sk-...)
Keep your API key secure!

Choose Your Interface

Perfect for quick predictions and testing.

1. Configure Your Key

boltz-lab config --api-key "sk-..."

2. Create a Job File

Save this as affinity.yaml.
sequences:
  - protein:
      id: ["A"]
      sequence: "MVTPEGNVSLVDESLLVGVTDEDRAVRSAHQFYER..."
      modifications: []
  - ligand:
      id: ["B"]
      smiles: "N[C@@H](Cc1ccc(O)cc1)C(=O)O"
constraints: []
properties:
  - affinity:
      binder: "B"
Full details on input formats are in the Input Formats section.

3. Run Your Prediction

# Default behavior: downloads into the current directory (.)
boltz-lab predict affinity.yaml

# Or pick an output directory
boltz-lab predict affinity.yaml --output ./results
That’s it! The CLI will:
  • Submit your job
  • Wait for completion (unless you use --no-wait)
  • Download results (by default into the current directory)
Use --no-wait to submit without waiting, or --format json for JSON output.

Example Input YAML Formats

Protein-Ligand Affinity

sequences:
  - protein:
      id: ["A"]
      sequence: "MVTPEGNVSLVDESLLVGVTDEDRAVRSAHQFYERLIGLWAPAVMEAAHELGVFAALAEAPADSGE..."
      modifications: []
  - ligand:
      id: ["B"]
      smiles: "N[C@@H](Cc1ccc(O)cc1)C(=O)O"
constraints: []
properties:
  - affinity:
      binder: "B"

RNA-Protein Complex

sequences:
  - protein:
      id: ["A"]
      sequence: "MPRGKLHKFLKRHKILNKQRELLQALEGFKQHFSKHEILLSPLGEEMRDRARAHLLKKVQK..."
      modifications: []
  - rna:
      id: ["B"]
      sequence: "GCGCAACGCGAACGCCACGCGGAACCGGCAACGGCAACG"
      modifications: []
constraints: []

Next Steps

Sandbox YAML Format

Input YAML format for Boltz Lab API prediction inputs

CLI Tool

Command-line interface for quick predictions

Python SDK

Python client for integration into your workflows

Boltz Lab User Guide

Learn to use the Boltz Lab web interface

Troubleshooting

Solution: Make sure the SDK is installed:
pip install boltz-lab
Solution: Check your API key is set correctly:
echo $BOLTZ_API_KEY
# or
boltz-lab config --show
Solution: Check your network connection and API endpoint:
boltz-lab config --show
# Verify endpoint is correct
Solution: Validate your YAML syntax:
python -c "import yaml; yaml.safe_load(open('job.yaml'))"